PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000175.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-other
Protein Properties Length: 203aa    MW: 23089.2 Da    PI: 7.6114
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000175.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-09871192355
                                     SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                        Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                     +yps+ ++  LA+++gLt +q+ +WF N+R ++
  FANhyb_rscf00000175.1.g00001.1  87 PYPSEPQKLALAASTGLTVKQINNWFINQRKRH 119
                                     8*****************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512138.943959IPR005539ELK domain
PROSITE profilePS5007112.7359122IPR001356Homeobox domain
SuperFamilySSF466894.28E-1960133IPR009057Homeodomain-like
SMARTSM003891.6E-1261126IPR001356Homeobox domain
CDDcd000864.59E-1562123No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2764127IPR009057Homeodomain-like
PfamPF059202.6E-1679118IPR008422Homeobox KN domain
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGHQVHAVSS TGDLVGQGGS SEEAGVNENC IDPRAKDWDI RAKLLQKYGG SLGSLSQELK  60
RKKKNGKLPK EARVQLQEWW SRNYTWPYPS EPQKLALAAS TGLTVKQINN WFINQRKRHW  120
KPSAEGMQLA MVDHSFQKMV DHPHFFYNYM DHLICNPSPM DCTSTPMDLY DVGQAMDSIC  180
LFWILDLDVH RSDLASPEPN KAM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267003.11e-116homeobox protein SBH1-like
SwissprotP466082e-46HSBH1_SOYBN; Homeobox protein SBH1
SwissprotQ388742e-46STM_ARATH; Homeobox protein SHOOT MERISTEMLESS
TrEMBLF5A6B31e-116F5A6B3_FRAVE; Knotted-like homeobox KNOX3
STRINGVIT_12s0059g01190.t011e-48(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-47KNOX/ELK homeobox transcription factor